PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000684.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family HB-PHD
Protein Properties Length: 672aa    MW: 76400.4 Da    PI: 7.2586
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000684.1_g00001.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.82.5e-10446490953
                              HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
                 Homeobox   9 keqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                              ++ +e L  +F++n  ps+e +  L+k+lgL+ ++V  WF+N R+
  Itr_sc000684.1_g00001.1 446 PNAVEKLRLVFAENELPSKEVKDNLSKELGLDSEKVNKWFKNARY 490
                              678999*************************************97 PP

2PHD37.94.2e-13173226149
                              SBTTTSSTCT..TSSEEEBS.SSSSEEETTTSTSSSSHHSHHSS..TBSSHHHH CS
                      PHD   1 rCkvCgksde..egelvlCd.gCkewfHlkClglkleseekpeg..ewlCeeCk 49 
                              +C+ C+  d+  +++++lCd +C+ +fH+kCl+++l++e++p +   w+C+ Ck
  Itr_sc000684.1_g00001.1 173 ICAKCKLRDAfpDNDIILCDgTCNCAFHQKCLDPPLSTENIPPDdeGWFCKFCK 226
                              588898844455********56*******************99999*******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579031.79E-14165231IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.105.2E-12169227IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001610.184171228IPR019787Zinc finger, PHD-finger
SMARTSM002492.2E-9173226IPR001965Zinc finger, PHD-type
PfamPF006283.4E-10173226IPR019787Zinc finger, PHD-finger
CDDcd155041.10E-29174225No hitNo description
PROSITE patternPS013590174225IPR019786Zinc finger, PHD-type, conserved site
Gene3DG3DSA:1.10.10.603.3E-13425489IPR009057Homeodomain-like
SuperFamilySSF466891.58E-9433490IPR009057Homeodomain-like
PROSITE profilePS5007112.163435495IPR001356Homeobox domain
SMARTSM003896.1E-9437499IPR001356Homeobox domain
CDDcd000861.16E-7438490No hitNo description
PfamPF000469.0E-8446490IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 672 aa     Download sequence    Send to blast
MVIENPREGK GKGSSIGKTL QKAIFSKTKS PDKQSALTSK VRKLQKVDSK KNGENEEADI  60
EYDRLKKRRR AKRRKRNAEL DEVSRLHRRT RYLLIKMKLE QNLIDAYSTE GWKGQSREKI  120
KPEKELERAK LQILKCKLGI REAVHQLDLL SSVGHIDDEV IAPDGSVHHE HIICAKCKLR  180
DAFPDNDIIL CDGTCNCAFH QKCLDPPLST ENIPPDDEGW FCKFCKIRME IIESTNVHLG  240
THFAVNSNWE DIFKEEAALP GGGDSLQCPE HEWPSDDSED DDYDPEKIEN SSSKSISNRE  300
SDDSDDASSS TSLGSLEDEL FVFTGRPEES IGFENNSADI IAMLDSDQTT DFEVLNGPRH  360
RTSVDYIKLN DELFGKNPPM NEQNSEDEDW GPTKRTRKKK EFESDAANTL MTLCENENDC  420
QEKQSTEVEE KSYSGKTRRS IFRIPPNAVE KLRLVFAENE LPSKEVKDNL SKELGLDSEK  480
VNKWFKNARY LALKGRKVEK TNPSKVVSPI ASEECAADTV KGKITEEVTA KDVATECAVQ  540
TPKNLKQTYR RKSAQKLICK SKKIQLRKAV RHSIGSNKAI VEFGDDMSLK LLRERVKKEK  600
RRLLCFNGKG GELEAEAEME RLCRIKNKVE RLQLVLLRLH DARSNKMVES PTPNSPFIYV  660
PVAELKEKTQ VS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16268DRLKKRR
26572KKRRRAKR
36675KRRRAKRRKR
4595602VKKEKRRL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015080840.10.0PREDICTED: pathogenesis-related homeodomain protein isoform X2
SwissprotP487851e-152PRH_ARATH; Pathogenesis-related homeodomain protein
TrEMBLK4CBZ20.0K4CBZ2_SOLLC; Uncharacterized protein
STRINGSolyc07g008730.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA106842123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.24e-97pathogenesis related homeodomain protein A